PDB entry 1z4o

View 1z4o on RCSB PDB site
Description: Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Class: isomerase
Keywords: isomerase, beta-phosphoglucomutase
Deposited on 2005-03-16, released 2005-04-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: Lactococcus lactis
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • see remark 999 (124)
      • see remark 999 (205)
    Domains in SCOP 1.75: d1z4oa1
  • Chain 'B':
    Compound: beta-phosphoglucomutase
    Species: Lactococcus lactis
    Gene: PGMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • see remark 999 (124)
      • see remark 999 (205)
    Domains in SCOP 1.75: d1z4ob1
  • Heterogens: MG, GL1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4oA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4oA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpavaaskpapdifiaaahavgvapsesigledsqagiqaikds
    galpigvgrpedlgddivivpdtshytleflkevwlqkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z4oB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4oB (B:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngpflle
    rmnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikdsgal
    pigvgrpedlgddivivpdtshytleflkevwlqk