PDB entry 1z4j

View 1z4j on RCSB PDB site
Description: Structure of the D41N variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Class: Hydrolase
Keywords: alfa beta fold, Hydrolase
Deposited on 2005-03-16, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'(3')-deoxyribonucleotidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPB1
      • engineered (9)
    Domains in SCOPe 2.07: d1z4ja_
  • Heterogens: MG, U2P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4jA (A:)
    ggralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsek
    aisiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyf
    gpdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrl
    hswaddwkaildskrpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4jA (A:)
    ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
    siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
    dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
    waddwkaildskrp