PDB entry 1z4h

View 1z4h on RCSB PDB site
Description: The response regulator TorI belongs to a new family of atypical excisionase
Deposited on 2005-03-16, released 2005-08-09
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tor inhibition protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z4hA (A:)
    mqhelqpdslvdlkfimadtgfgktfiydriksgdlpkakvihgrarwlyrdhcefknkl
    lsrang