PDB entry 1z4e

View 1z4e on RCSB PDB site
Description: Crystal structure of transcriptional regulator from Bacillus halodurans C-125
Class: transcription regulator
Keywords: NYSGXRC target T2017, GNAT fold, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGRC, TRANSCRIPTION REGULATOR
Deposited on 2005-03-15, released 2005-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z4ea1
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z4eb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4eA (A:)
    mnihvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknneliva
    cngeeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergch
    liqlttdkqrpdalrfyeqlgfkasheglkmhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4eA (A:)
    hvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacng
    eeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliq
    lttdkqrpdalrfyeqlgfkasheglkmhf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z4eB (B:)
    mnihvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknneliva
    cngeeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergch
    liqlttdkqrpdalrfyeqlgfkasheglkmhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4eB (B:)
    hvtireategdleqmvhmladdvlgrkreryekplpvsyvrafkeikkdknnelivacng
    eeivgmlqvtftpyltyqgswratiegvrthsaargqgigsqlvcwaierakergchliq
    lttdkqrpdalrfyeqlgfkasheglkmhf