PDB entry 1z4b

View 1z4b on RCSB PDB site
Description: RadA recombinase in complex with ADP
Class: recombination
Keywords: ATPase, protein-ATP complex, rada/ADP complex, co-factors, potassium-dependence
Deposited on 2005-03-15, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.234
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4ba1, d1z4ba2
  • Heterogens: MG, K, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4bA (A:)
    mgdnltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlc
    dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
    nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
    raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
    lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
    ydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4bA (A:)
    ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
    ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
    peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
    sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
    adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd