PDB entry 1z48

View 1z48 on RCSB PDB site
Description: Crystal structure of reduced YqjM from Bacillus subtilis
Class: oxidoreductase
Keywords: flavin, FMN, beta-alpha-barrel, OXIDOREDUCTASE
Deposited on 2005-03-15, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable NADH-dependent flavin oxidoreductase yqjM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54550 (Start-337)
      • modified residue (13)
      • modified residue (21)
      • modified residue (24)
      • modified residue (26)
      • modified residue (41)
      • modified residue (133)
      • modified residue (237)
      • modified residue (277)
      • modified residue (284)
      • modified residue (290)
    Domains in SCOPe 2.07: d1z48a_
  • Chain 'B':
    Compound: Probable NADH-dependent flavin oxidoreductase yqjM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54550 (Start-337)
      • modified residue (13)
      • modified residue (21)
      • modified residue (24)
      • modified residue (26)
      • modified residue (41)
      • modified residue (133)
      • modified residue (237)
      • modified residue (277)
      • modified residue (284)
      • modified residue (290)
    Domains in SCOPe 2.07: d1z48b_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z48A (A:)
    marklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliivea
    savnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifaps
    aiafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsn
    hrtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmke
    qgvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngr
    adlifigrellrdpffartaakqlnteipapvqyergw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z48A (A:)
    arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
    avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
    iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
    rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
    gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
    dlifigrellrdpffartaakqlnteipapvqyergw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z48B (B:)
    marklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliivea
    savnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifaps
    aiafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsn
    hrtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmke
    qgvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngr
    adlifigrellrdpffartaakqlnteipapvqyergw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z48B (B:)
    arklftpitikdmtlknrivmspmcmysshekdgkltpfhmahyisraigqvgliiveas
    avnpqgritdqdlgiwsdehiegfaklteqvkeqgskigiqlahagrkaelegdifapsa
    iafdeqsatpvemsaekvketvqefkqaaarakeagfdvieihaahgyliheflsplsnh
    rtdeyggspenryrflreiidevkqvwdgplfvrvsasdytdkgldiadhigfakwmkeq
    gvdlidcssgalvhadinvfpgyqvsfaekireqadmatgavgmitdgsmaeeilqngra
    dlifigrellrdpffartaakqlnteipapvqyergw