PDB entry 1z47

View 1z47 on RCSB PDB site
Description: structure of the atpase subunit cysa of the putative sulfate atp- binding cassette (abc) transporter from alicyclobacillus acidocaldarius
Deposited on 2005-03-15, released 2005-06-07
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ABC-transporter ATP-binding protein
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Gene: cysA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RHZ7 (12-354)
      • expression tag (10-11)
  • Chain 'B':
    Compound: putative ABC-transporter ATP-binding protein
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Gene: cysA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z47A (A:)
    mrghhhhhhhgsmtiefvgvekiypggarsvrgvsfqiregemvgllgpsgsgkttilrl
    iaglerptkgdvwiggkrvtdlppqkrnvglvfqnyalfqhmtvydnvsfglrekrvpkd
    emdarvrellrfmrlesyanrfphelsggqqqrvalaralaprpqvllfdepfaaidtqi
    rrelrtfvrqvhdemgvtsvfvthdqeealevadrvlvlhegnveqfgtpeevyekpgtl
    fvasfigesnvwtravqngrievagaalpvdpavsegsevavvvrpkdvelqpasereah
    aqvvrsafkgsysacwirtkdgevwevhvpsadrhrwspgawvhmnvtrwfifpr
    

    Sequence, based on observed residues (ATOM records):
    >1z47A (A:)
    gsmtiefvgvekiypggarsvrgvsfqiregemvgllgpsgsgkttilrliaglerptkg
    dvwiggkrvtdlppqkrnvglvfqnyalfqhmtvydnvsfglrekrvpkdemdarvrell
    rfmrlesyanrfphelsggqqqrvalaralaprpqvllfdepfaaidtqirrelrtfvrq
    vhdemgvtsvfvthdqeealevadrvlvlhegnveqfgtpeevyekpgtlfvasfigesn
    vwtravqngrievagaalpvdpavsegsevavvvrpkdvelqpasereahaqvvrsafkg
    sysacwirtkdgevwevhvpsadrhrwspgawvhmnvtrwfifpr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z47B (B:)
    mrghhhhhhhgsmtiefvgvekiypggarsvrgvsfqiregemvgllgpsgsgkttilrl
    iaglerptkgdvwiggkrvtdlppqkrnvglvfqnyalfqhmtvydnvsfglrekrvpkd
    emdarvrellrfmrlesyanrfphelsggqqqrvalaralaprpqvllfdepfaaidtqi
    rrelrtfvrqvhdemgvtsvfvthdqeealevadrvlvlhegnveqfgtpeevyekpgtl
    fvasfigesnvwtravqngrievagaalpvdpavsegsevavvvrpkdvelqpasereah
    aqvvrsafkgsysacwirtkdgevwevhvpsadrhrwspgawvhmnvtrwfifpr
    

    Sequence, based on observed residues (ATOM records):
    >1z47B (B:)
    tiefvgvekiypggarsvrgvsfqiregemvgllgpsgsgkttilrliaglerptkgdvw
    iggkrvtdlppqkrnvglvfqnyalfqhmtvydnvsfglrekrvpkdemdarvrellrfm
    rlesyanrfphelsggqqqrvalaralaprpqvllfdepfaaidtqirrelrtfvrqvhd
    emgvtsvfvthdqeealevadrvlvlhegnveqfgtpeevyekpgtlfvasfigesnvwt
    ravqngrievagaalpvdpavsegsevavvvrpkdvelqpasereahaqvvrsafkgsys
    acwirtkdgevwevhvpsadrhrwspgawvhmnvtrwfifpr