PDB entry 1z45

View 1z45 on RCSB PDB site
Description: Crystal structure of the gal10 fusion protein galactose mutarotase/UDP-galactose 4-epimerase from Saccharomyces cerevisiae complexed with NAD, UDP-glucose, and galactose
Class: isomerase
Keywords: epimerase, mutarotase, metabolism,
Deposited on 2005-03-15, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GAL10 bifunctional protein
    Species: Saccharomyces cerevisiae
    Gene: GAL10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04397 (Start-698)
      • engineered (517)
    Domains in SCOP 1.73: d1z45a1, d1z45a2
  • Heterogens: GAL, NA, NAD, GUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z45A (A:)
    mtaqlqsestskivlvtggagyigshtvveliengydcvvadnlsnstydsvarlevltk
    hhipfyevdlcdrkglekvfkeykidsvihfaglkavgestqiplryyhnnilgtvvlle
    lmqqynvskfvfsssatvygdatrfpnmipipeecplgptnpyghtkyaienilndlyns
    dkkswkfailryfnpigahpsgligedplgipnnllpymaqvavgrreklyifgddydsr
    dgtpirdyihvvdlakghiaalqyleayneneglcrewnlgsgkgstvfevyhafckasg
    idlpykvtgrragdvlnltakpdrakrelkwqtelqvedsckdlwkwttenpfgyqlrgv
    earfsaedmrydarfvtigagtrfqatfanlgasivdlkvngqsvvlgyeneegylnpds
    ayigatigryanriskgkfslcnkdyqltvnngvnanhssigsfhrkrflgpiiqnpskd
    vftaeymlidnekdtefpgdllvtiqytvnvaqksleivykgkltageatpinltnhsyf
    nlnkpygdtiegteimvrskksvdvdknmiptgnivdreiatfnstkptvlgpknpqfdc
    cfvvdenakpsqintlnneltlivkafhpdsnitlevlsteptyqfytgdflsagyearq
    gfaiepgryidainqenwkdcvtlkngetygskivyrfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z45A (A:)
    skivlvtggagyigshtvveliengydcvvadnlsnstydsvarlevltkhhipfyevdl
    cdrkglekvfkeykidsvihfaglkavgestqiplryyhnnilgtvvllelmqqynvskf
    vfsssatvygdatrfpnmipipeecplgptnpyghtkyaienilndlynsdkkswkfail
    ryfnpigahpsgligedplgipnnllpymaqvavgrreklyifrdgtpirdyihvvdlak
    ghiaalqyleayneneglcrewnlgsgkgstvfevyhafckasgidlpyvlnltakpdra
    krelkwqtelqvedsckdlwkwttenpfgyqlrgvearfsaedmrydarfvtigagtrfq
    atfanlgasivdlkvngqsvvlgyeneegylnpdsayigatigryanriskgkfslcnkd
    yqltvnngvnanhssigsfhrkrflgpiiqnpskdvftaeymlidnekdtefpgdllvti
    qytvnvaqksleivykgkltageatpinltnhsyfnlnkpygdtiegteimvrskksvdv
    dknmiptgnivdreiatfnstkptvlgpknpqfdccfvvdenakpsqintlnneltlivk
    afhpdsnitlevlsteptyqfytgdflsagyearqgfaiepgryidainqenwkdcvtlk
    ngetygskivyrfs