PDB entry 1z40

View 1z40 on RCSB PDB site
Description: ama1 from plasmodium falciparum
Deposited on 2005-03-14, released 2005-08-16
The last revision was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1 precursor
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: apical membrane antigen 1 precursor
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z40A (A:)
    gnymgnpwteymakydieevhgsgirvdlgedaevagtqyrlpsgkcpvfgkgiiiensn
    ttfltpvatgnqylkdggfafppteplmspmtldemrhfykdnkyvknldeltlcsrhag
    nmipdndknsnykypavyddkdkkchilyiaaqenngprycnkdeskrnsmfcfrpakdi
    sfqnytylsknvvdnwekvcprknlqnakfglwvdgncediphvnefpaidlfecnklvf
    elsasdqpkqyeqhltdyekikegfknknasmiksaflptgafkadrykshgkgynwgny
    ntetqkceifnvkptclinnssyiattalshpieve
    

    Sequence, based on observed residues (ATOM records):
    >1z40A (A:)
    npwteymakydieevhgsgirvdlgedaevagtqyrlpsgkcpvfgkgiiiensnttflt
    pvatkdggfafppteplmspmtldemrhfykdnkyvknldeltlcsrhagnmipdndkns
    nykypavyddkdkkchilyiaaqenngprycfcfrpakdisfqnytylsknvvdnwekvc
    prknlqnakfglwvdgncediphvnefpaidlfecnklvfelsasdqpkqyeqhltdyek
    ikegfknknasmiksaflptdrykshgkgynwgnyntetqkceifnvkptclinnssyia
    ttalshpieve
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1z40E (E:)
    gnymgnpwteymakydieevhgsgirvdlgedaevagtqyrlpsgkcpvfgkgiiiensn
    ttfltpvatgnqylkdggfafppteplmspmtldemrhfykdnkyvknldeltlcsrhag
    nmipdndknsnykypavyddkdkkchilyiaaqenngprycnkdeskrnsmfcfrpakdi
    sfqnytylsknvvdnwekvcprknlqnakfglwvdgncediphvnefpaidlfecnklvf
    elsasdqpkqyeqhltdyekikegfknknasmiksaflptgafkadrykshgkgynwgny
    ntetqkceifnvkptclinnssyiattalshpieve
    

    Sequence, based on observed residues (ATOM records):
    >1z40E (E:)
    npwteymakydieevhgsgirvdlgedaevagtqyrlpsgkcpvfgkgiiiensnttflt
    pvatkdggfafppteplmspmtldemrhfykdnkyvknldeltlcsrhagnmipdndkns
    nykypavyddkdkkchilyiaaqennmfcfrpakdisfqnytylsknvvdnwekvcprkn
    lqnakfglwvdgncediphvnefpaidlfecnklvfelsasdqpkqyeqhltdyekikeg
    fknknasmiksaflpdrykshgkgynwgnyntetqkceifnvkptclinnssyiattals
    hpieve