PDB entry 1z3z

View 1z3z on RCSB PDB site
Description: The crystal structure of a DGD mutant: Q52A
Class: lyase
Keywords: DGD mutant, LYASE
Deposited on 2005-03-14, released 2006-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dialkylglycine decarboxylase
    Species: Burkholderia cepacia [TaxId:292]
    Gene: dgdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16932 (0-430)
      • see remark 999 (12)
      • engineered (49)
      • see remark 999 (78)
    Domains in SCOPe 2.07: d1z3za1
  • Heterogens: NA, K, PLP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3zA (A:)
    lnddatfwrnarhhlvryggtfepmiierakgsfvydadgraildftsgamsavlghchp
    eivsvigeyagkldhlfsemlsrpvvdlatrlanitppgldralllstgaesneaairma
    klvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprfernga
    ydylaeldyafdlidrqssgnlaafiaepilssggiielpdgymaalkrkceargmllil
    deaqtgvgrtgtmfacqrdgvtpdiltlsktlgaglplaaivtsaaieerahelgylfyt
    thvsdplpaavglrvldvvqrdglvaranvmgdrlrrglldlmerfdcigdvrgrglllg
    veivkdrrtkepadglgakitrecmnlglsmnivqlpgmggvfriappltvsedeidlgl
    sllgqaieral