PDB entry 1z3y

View 1z3y on RCSB PDB site
Description: Structure of Gun4-1 from Thermosynechococcus elongatus
Class: Transferase Activator
Keywords: Transferase Activator
Deposited on 2005-03-14, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytidyltransferase
    Species: THERMOSYNECHOCOCCUS ELONGATUS
    Gene: gun4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIJ1 (3-237)
      • cloning artifact (0-2)
      • engineered (107)
    Domains in SCOP 1.73: d1z3ya1, d1z3ya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3yA (A:)
    pefmvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppap
    wirgqayrllfhspeasvqaflqqhypqgviplrsdrgvdyqelaklfvaekfeaadrlt
    tqklcelagplaqkrrwlyfteveqlpipdlqtidqlwlafslgrfgysvqrqlwlgcgq
    nwdrlwekigwrqgkrwprypnefiwdlsaprghlpltnqlrgvqvlnallnhpawta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3yA (A:)
    pefmvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwi
    rgqayrllfhspeasvqaflqqhypqgviplrsdrgvdyqelaklfvaekfeaadrlttq
    klcelagplaqkrrwlyfteveqlpipdlqtidqlwlafslgrfgysvqrqlwlgcgqnw
    drlwekigwrqgkrwprypnefiwdlsaprghlpltnqlrgvqvlnallnhpawta