PDB entry 1z3x

View 1z3x on RCSB PDB site
Description: Structure of Gun4 from Thermosynechococcus elongatus
Class: Transferase Activator
Keywords: Transferase Activator
Deposited on 2005-03-14, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.18
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytidyltransferase
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Gene: gun4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DIJ1 (3-237)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (29)
    Domains in SCOPe 2.07: d1z3xa1, d1z3xa2, d1z3xa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3xA (A:)
    pefmvttepaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppap
    wirgqayrllfhspeasvqaflqqhypqgviplrsdrgvdyqelakllvaekfeaadrlt
    tqklcelagplaqkrrwlyfteveqlpipdlqtidqlwlafslgrfgysvqrqlwlgcgq
    nwdrlwekigwrqgkrwprypnefiwdlsaprghlpltnqlrgvqvlnallnhpawta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3xA (A:)
    pefmvtpaladlqeqlyngneksqlaamstlstagtegyhllqeflkdsatfspppapwi
    rgqayrllfhspeasvqaflqqhypqgviplrsdrgvdyqelakllvaekfeaadrlttq
    klcelagplaqkrrwlyfteveqlpipdlqtidqlwlafslgrfgysvqrqlwlgcgqnw
    drlwekigwrqgkrwprypnefiwdlsaprghlpltnqlrgvqvlnallnhpawta