PDB entry 1z3t

View 1z3t on RCSB PDB site
Description: Structure of Phanerochaete chrysosporium cellobiohydrolase Cel7D (CBH58) in complex with cellobiose
Class: hydrolase
Keywords: Beta sandwich, HYDROLASE
Deposited on 2005-03-14, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: PHANEROCHAETE CHRYSOSPORIUM [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z3ta_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3tA (A:)
    eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
    cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
    nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
    ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
    ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
    qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
    lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
    gdigstfsgts