PDB entry 1z3s

View 1z3s on RCSB PDB site
Description: Angiopoietin-2 Receptor Binding Domain
Class: signaling protein
Keywords: angiogenesis, Tie2 binding, SIGNALING PROTEIN
Deposited on 2005-03-14, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15123 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1z3sa1, d1z3sa2
  • Chain 'B':
    Compound: Angiopoietin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15123 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1z3sb1, d1z3sb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3sA (A:)
    efrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
    keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
    rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
    ypqrqntnkfngikwyywkgsgyslkattmmirpadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3sA (A:)
    efrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
    keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
    rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
    ypqrqntnkfngikwyywkgsgyslkattmmirpad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z3sB (B:)
    efrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
    keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
    rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
    ypqrqntnkfngikwyywkgsgyslkattmmirpadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3sB (B:)
    efrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
    keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
    rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
    ypqrqntnkfngikwyywkgsgyslkattmmirpad