PDB entry 1z3i

View 1z3i on RCSB PDB site
Description: Structure of the SWI2/SNF2 chromatin remodeling domain of eukaryotic Rad54
Class: Recombination/DNA binding
Keywords: Recombination ATPase helicase, Recombination-DNA binding COMPLEX
Deposited on 2005-03-12, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: similar to RAD54-like
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z3ix1, d1z3ix2
  • Heterogens: ZN, SO4

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3iX (X:)
    lglrragvrkalhdpfedgalvlyeppaisahdlikadkeklpvhvvvdpvlskvlrphq
    regvkflwdcvtgrriensygcimademglgktlqcitliwtllkqspdckpeidkvivv
    spsslvrnwynevgkwlggrvqpvaidggskdeidsklvnfisqqgmriptpiliisyet
    frlhaevlhkgkvglvicdeghrlknsdnqtylalnsmnaqrrvlisgtpiqndlleyfs
    lvhfvnsgilgtaqefkkrfeipilkgrdadasdkdraageqklqelisivnrclirrts
    dilskylpvkieqvvccnltplqkelyklflkqakpveslqtgkisvsslssitslkklc
    nhpaliyekcltgeegfdgaldlfpqnystkavepqlsgkmlvldyilamtrtttsdkvv
    lvsnytqtldlfeklcrnrrylyvrldgtmsikkrakiverfnnpsspefifmlsskagg
    cglnliganrlvmfdpdwnpandeqamarvwrdgqkktcyiyrllstgtieekilqrqah
    kkalsscvvdeeqdverhfslgelrelfslnektlsdthdrfrcrrcvngrqvrpppdds
    dctcdlsnwhhcadkrglrdpvlqaswdaavsfvfhqrshedqr