PDB entry 1z3h

View 1z3h on RCSB PDB site
Description: The exportin Cse1 in its cargo-free, cytoplasmic state
Class: protein transport
Keywords: Cse1, Exportin, Nuclear transport, HEAT repeat
Deposited on 2005-03-12, released 2005-05-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.241
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin alpha re-exporter
    Species: Saccharomyces cerevisiae
    Gene: Cse1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z3ha1
  • Chain 'B':
    Compound: importin alpha re-exporter
    Species: Saccharomyces cerevisiae
    Gene: Cse1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1z3hb1
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3hA (A:)
    msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
    fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
    wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
    llktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyl
    sysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsis
    nqpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfedd
    pieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwk
    fkdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaik
    yiytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhke
    disnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfi
    eivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipy
    vfqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlv
    pvlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvk
    kltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvln
    mvingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvs
    isekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvgn
    rshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3hA (A:)
    sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
    knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
    ptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnl
    lktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyls
    ysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisn
    qpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddp
    ieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkf
    kdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaiky
    iytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiressnsteillknli
    alilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnpr
    fthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyvfqiiafvveqsat
    ipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaska
    yevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklg
    sdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskypt
    lisstmnsiietassqsgshfsklvsisekpfdplpeidvnngvrlyvaealnkynaisg
    ntflntilpqltqenqvklnqllvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z3hB (B:)
    msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
    fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
    wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
    llktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyl
    sysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsis
    nqpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfedd
    pieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwk
    fkdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaik
    yiytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhke
    disnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfi
    eivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipy
    vfqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlv
    pvlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvk
    kltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvln
    mvingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvs
    isekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvgn
    rshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3hB (B:)
    sdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalff
    knfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrw
    ptllsdlasrlsnddmvtnkgvltvahsifkrwrpldelfleiklvldvftapflnllkt
    vdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkylsysn
    plledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisnqpk
    ydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddpiey
    irrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwkfkdl
    yiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaikyiyt
    frnqltkaqlielmpilatflqtdeyvvytyaaitiekiltisteillknlialilkhsp
    eklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnprfthytfesig
    ailnytqrqnlpllvdsmmptfltvfdiqefipyvfqiiafvveqsatipesikplaqpl
    lapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaskayevhgfdllehi
    mllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklgsdflihfidevq
    dglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskyptlisstmnsiiet
    assqsianlfsklvsisekpfdplpeidvnngvrlyvaealnkynaisgntflntilpql
    tqenqvklnqllvg