PDB entry 1z3d

View 1z3d on RCSB PDB site
Description: Protein crystal growth improvement leading to the 2.5A crystallographic structure of ubiquitin-conjugating enzyme (ubc-1) from Caenorhabditis elegans
Class: ligase
Keywords: E2, Ubiquitination, Ubiquitin-conjugating, crystal growth, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, LIGASE
Deposited on 2005-03-11, released 2005-03-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ubc-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z3da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3dA (A:)
    gshmttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklsl
    efteeypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepn
    pnspanslaaqlyqenrreyekrvqqiveqswlnfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3dA (A:)
    ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
    eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
    anslaaqlyqenrreyekrvqqiveqswlnf