PDB entry 1z3a

View 1z3a on RCSB PDB site
Description: Crystal structure of tRNA adenosine deaminase TadA from Escherichia coli
Class: hydrolase
Keywords: tRNA adenosine deaminase, dimer, zinc, metalloenzyme, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2005-03-10, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-30, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-specific adenosine deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: TADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z3aa1
  • Chain 'B':
    Compound: tRNA-specific adenosine deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: TADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z3ab_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z3aA (A:)
    mlsevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahae
    imalrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmd
    vlhhpgmnhrveitegiladecaallsdffrmrrqeikaqkkaqsstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3aA (A:)
    sevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahaeim
    alrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvl
    hhpgmnhrveitegiladecaallsdffrmrrqeik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z3aB (B:)
    mlsevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahae
    imalrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmd
    vlhhpgmnhrveitegiladecaallsdffrmrrqeikaqkkaqsstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z3aB (B:)
    sevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahaeim
    alrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvl
    hhpgmnhrveitegiladecaallsdffrmrrqeik