PDB entry 1z39

View 1z39 on RCSB PDB site
Description: Crystal structure of Trichomonas vaginalis purine nucleoside phosphorylase complexed with 2'-deoxyinosine
Class: transferase
Keywords: alpha-beta-alpha sandwich, TRANSFERASE
Deposited on 2005-03-10, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z39 (0-234)
    Domains in SCOPe 2.07: d1z39a_
  • Heterogens: 2ND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z39A (A:)
    atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
    ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
    mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
    esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z39A (A:)
    atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
    ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
    mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
    esaglfpiadlygaragcictvsdhilhheerqnsfqnmmkialeaaikl