PDB entry 1z2z

View 1z2z on RCSB PDB site
Description: crystal structure of the putative trna pseudouridine synthase d (trud) from methanosarcina mazei, northeast structural genomics target mar1
Deposited on 2005-03-10, released 2005-04-26
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tRNA pseudouridine synthase D
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: TRUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Q0M2 (0-End)
      • modified residue (0)
      • modified residue (242-243)
      • modified residue (267)
      • modified residue (325)
      • modified residue (378)
      • modified residue (414)
      • modified residue (429)
      • modified residue (436)
  • Chain 'B':
    Compound: Probable tRNA pseudouridine synthase D
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: TRUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Q0M2 (0-End)
      • modified residue (0)
      • modified residue (242-243)
      • modified residue (267)
      • modified residue (325)
      • modified residue (378)
      • modified residue (414)
      • modified residue (429)
      • modified residue (436)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z2zA (A:)
    mevpeiekqiginlystdttglggqlrqeiedfivkeitnreegeegkyliveltkrdwd
    thhltrtlsrilqvsqkrisvagtkdkralttqkisifdtdaseiekihlkdielkvlgr
    srksvelgdlwgndfritvrnienspeeteallkkttdeilaqggvpnffgiqrfgsvrp
    vthlvgkaivegnfekaallyiaepfpeepeetknarqfvkdtldfkeglktyplrlghe
    rammnhlianpedysgsfrvlpqnlyrmfvhgyqsyiyniilcrrieagiplnravegdi
    vcfrnevglpdssktekvtsetvnamnrllklgrafitaplpgyntefasgipgeiengv
    lkelgvslegfniekfpemsskgtrrevllevkpkfeagedelnpgkskavlefmlpkgs
    yattvlreymkvnplqmslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z2zA (A:)
    mevpeiekqiginlystdttglggqlrqeiedfivkeitnreegeegkyliveltkrdwd
    thhltrtlsrilqvsqkrisvagtkdkralttqkisifdtdaseiekihlkdielkvlgr
    srksvelgdlwgndfritvrnienspeeteallkkttdeilaqggvpnffgiqrfgsvrp
    vthlvgkaivegnfekaallyiaepfpeepeetknarqfvkdtldfkeglktyplrlghe
    rammnhlianpedysgsfrvlpqnlyrmfvhgyqsyiyniilcrrieagiplnravegdi
    vcfrnevglpdssktekvtsetvnamnrllklgrafitaplpgyntefasgipgeiengv
    lkelgvslegfniekfpemsskgtrrevllevkpkfeagedelnpgkskavlefmlpkgs
    yattvlreymkvnplqm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z2zB (B:)
    mevpeiekqiginlystdttglggqlrqeiedfivkeitnreegeegkyliveltkrdwd
    thhltrtlsrilqvsqkrisvagtkdkralttqkisifdtdaseiekihlkdielkvlgr
    srksvelgdlwgndfritvrnienspeeteallkkttdeilaqggvpnffgiqrfgsvrp
    vthlvgkaivegnfekaallyiaepfpeepeetknarqfvkdtldfkeglktyplrlghe
    rammnhlianpedysgsfrvlpqnlyrmfvhgyqsyiyniilcrrieagiplnravegdi
    vcfrnevglpdssktekvtsetvnamnrllklgrafitaplpgyntefasgipgeiengv
    lkelgvslegfniekfpemsskgtrrevllevkpkfeagedelnpgkskavlefmlpkgs
    yattvlreymkvnplqmslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z2zB (B:)
    mevpeiekqiginlystdttglggqlrqeiedfivkeitnreegeegkyliveltkrdwd
    thhltrtlsrilqvsqkrisvagtkdkralttqkisifdtdaseiekihlkdielkvlgr
    srksvelgdlwgndfritvrnienspeeteallkkttdeilaqggvpnffgiqrfgsvrp
    vthlvgkaivegnfekaallyiaepfpeepeetknarqfvkdtldfkeglktyplrlghe
    rammnhlianpedysgsfrvlpqnlyrmfvhgyqsyiyniilcrrieagiplnravegdi
    vcfrnevglpdssktekvtsetvnamnrllklgrafitaplpgyntefasgipgeiengv
    lkelgvslegfniekfpemsskgtrrevllevkpkfeagedelnpgkskavlefmlpkgs
    yattvlreymkvnplqm