PDB entry 1z2w

View 1z2w on RCSB PDB site
Description: Crystal structure of mouse Vps29 complexed with Mn2+
Class: protein transport
Keywords: Vps29, retromer, phosphatase, manganese, PROTEIN TRANSPORT
Deposited on 2005-03-10, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vacuolar protein sorting 29
    Species: Mus musculus [TaxId:10090]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2wa1
  • Chain 'B':
    Compound: vacuolar protein sorting 29
    Species: Mus musculus [TaxId:10090]
    Gene: Vps29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2wb_
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2wA (A:)
    gspefgtrdrmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylk
    tlagdvhivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdi
    lisghthkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligd
    dvkverieykks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2wA (A:)
    mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
    gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
    afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
    ks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z2wB (B:)
    gspefgtrdrmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylk
    tlagdvhivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdi
    lisghthkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligd
    dvkverieykks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2wB (B:)
    mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
    gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
    afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
    ks