PDB entry 1z2v

View 1z2v on RCSB PDB site
Description: Crystal Structure of Glu60 deletion Mutant of Human Acidic Fibroblast Growth Factor
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2005-03-09, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2va1, d1z2va2
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2vb1, d1z2vb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2vA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yiksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2vA (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    ksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z2vB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yiksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2vB (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    ksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv