PDB entry 1z2u

View 1z2u on RCSB PDB site
Description: The 1.1A crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from Caenorhabditis elegans: functional and evolutionary significance
Class: ligase
Keywords: PSI, SECSG, ubiquitin-conjugating enzyme, Caenorhabditis elegans, proteosome pathway, Structural Genomics, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, LIGASE
Deposited on 2005-03-09, released 2005-03-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.131
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ubc-2, let-70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35129 (3-149)
      • cloning artifact (0-2)
    Domains in SCOPe 2.03: d1z2ua1
  • Heterogens: CL, NA, BU3, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z2uA (A:)
    gshmalkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrerynqlarewtqkyam