PDB entry 1z2u

View 1z2u on RCSB PDB site
Description: The 1.1A crystallographic structure of ubiquitin-conjugating enzyme (ubc-2) from Caenorhabditis elegans: functional and evolutionary significance
Class: ligase
Keywords: PSI, SECSG, ubiquitin-conjugating enzyme, Caenorhabditis elegans, proteosome pathway, Structural Genomics, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, LIGASE
Deposited on 2005-03-09, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-conjugating enzyme E2 2
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: ubc-2, let-70
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35129 (3-149)
    • cloning artifact (0-2)
  Domains in SCOPe 2.07: d1z2ua1, d1z2ua2
• Heterogens: CL, NA, BU3, UNX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z2uA (A:)
  gshmalkriqkelqdlgrdppaqcsagpvgddlfhwqatimgppespyqggvffltihfp
  tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
  plvpeiariyktdrerynqlarewtqkyam