PDB entry 1z2r

View 1z2r on RCSB PDB site
Description: Structure of the ABC transporter MSBA in complex with adp-vanadate and lipopolysaccharide
Deposited on 2005-03-09, released 2005-05-24
The last revision was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.28
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: SALMONELLA TYPHIMURIUM
    Gene: msbA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: SALMONELLA TYPHIMURIUM
    Gene: msbA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: SALMONELLA TYPHIMURIUM
    Gene: msbA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: SALMONELLA TYPHIMURIUM
    Gene: msbA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, VO4, FTT, DPO, ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z2rA (A:)
    mhndkdlstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktd
    rsvllwmplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsi
    airvvskrfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tieqadeivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records):
    >1z2rA (A:)
    wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
    vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
    ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
    rsisknmqntmgqvttsaerlqgmkmvsassisdpiiqliaslalafvlyaasfpsvmds
    ltagtitvvfssmialmrplksltnvnaqfqrgmaaefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergth
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z2rB (B:)
    mhndkdlstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktd
    rsvllwmplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsi
    airvvskrfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tieqadeivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records):
    >1z2rB (B:)
    wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
    vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
    ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
    rsisknmqntmgqvttsaerlqgmkmvsassisdpiiqliaslalafvlyaasfpsvmds
    ltagtitvvfssmialmrplksltnvnaqfqrgmaaefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergth
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1z2rF (F:)
    mhndkdlstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktd
    rsvllwmplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsi
    airvvskrfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tieqadeivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records):
    >1z2rF (F:)
    wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
    vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
    ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
    rsisknmqntmgqvttsaerlqgmkmvsassisdpiiqliaslalafvlyaasfpsvmds
    ltagtitvvfssmialmrplksltnvnaqfqrgmaaefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergth
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1z2rG (G:)
    mhndkdlstwqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktd
    rsvllwmplvviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqs
    tgtllsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsi
    airvvskrfrsisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnkmrlq
    gmkmvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplks
    ltnvnaqfqrgmaacqtlfaildseqekdegkrvidratgdlefrnvtftypgrevpalr
    ninlkipagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqva
    lvsqnvhlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvl
    lsggqrqriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrls
    tieqadeivvvedgiivergthsellaqhgvyaqlhkmqfgq
    

    Sequence, based on observed residues (ATOM records):
    >1z2rG (G:)
    wqtfrrlwptiapfkaglivagialilnaasdtfmlsllkpllddgfgktdrsvllwmpl
    vviglmilrgitsyissyciswvsgkvvmtmrrrlfghmmgmpvaffdkqstgtllsrit
    ydseqvassssgalitvvregasiiglfimmfyyswqlsiilvvlapivsiairvvskrf
    rsisknmqntmgqvttsaerlqgmkmvsassisdpiiqliaslalafvlyaasfpsvmds
    ltagtitvvfssmialmrplksltnvnaqfqrgmaaefrnvtftypgrevpalrninlki
    pagktvalvgrsgsgkstiaslitrfydideghilmdghdlreytlaslrnqvalvsqnv
    hlfndtvanniayarteeysreqieeaarmayamdfinkmdngldtiigengvllsggqr
    qriaiarallrdspilildeatsaldteseraiqaaldelqknrtslviahrlstieqad
    eivvvedgiivergth