PDB entry 1z2q

View 1z2q on RCSB PDB site
Description: High-resolution solution structure of the LM5-1 FYVE domain from Leishmania major
Class: membrane protein
Keywords: MEMBRANE PROTEIN, FYVE domain, Zinc-finger
Deposited on 2005-03-08, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lm5-1
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z2Q (0-83)
    Domains in SCOPe 2.06: d1z2qa1, d1z2qa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1z2qA (A:)
gplgsmgekqskgywqededapacngcgcvftttvrrhhcrncgyvlcgdcsrhraaipm
rgitepervcdacylalrssnmag