PDB entry 1z2n

View 1z2n on RCSB PDB site
Description: Inositol 1,3,4-trisphosphate 5/6-kinase complexed Mg2+/ADP
Deposited on 2005-03-08, released 2005-04-19
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.182
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: inositol 1,3,4-trisphosphate 5/6-kinase
    Species: Entamoeba histolytica [TaxId:294381]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1z2nX (X:)
    gplgsmttkqtvslfiwlpeskqktlfistknhtqfelnniifdvtlstelpdkepnaii
    tkrthpvgkmademrkyekdhpkvlflessaihdmmssreeinalliknnipipnsfsvk
    skeeviqllqskqlilpfivkpenaqgtfnahqmkivleqegiddihfpclcqhyinhnn
    kivkvfcigntlkwqtrtslpnvhrcgiksvdfnnqhledilswpegvidkqdiiensan
    rfgskiledpillnltseaemrdlaykvrcalgvqlcgidfikeneqgnplvvdvnvfps
    yggkvdfdwfvekvalcytevaki
    

    Sequence, based on observed residues (ATOM records):
    >1z2nX (X:)
    qtvslfiwlpeskqktlfistknhtqfelnniifdvtlstelpdkepnaiitkrthpvgk
    mademrkyekdhpkvlflessaihdmmssreeinalliknnipipnsfsvkskeeviqll
    qskqlilpfivkpenaqgtfnahqmkivleqegiddihfpclcqhyinhnnkivkvfcig
    ntlkwqtrtslpnvhrcgiksvdfnnqhledilswpegvidkqdiiensanrfgskiled
    pillnltseaemrdlaykvrcalgvqlcgidfikeneqgnplvvdvnvfpsyggkvdfdw
    fvekvalcyte