PDB entry 1z2m

View 1z2m on RCSB PDB site
Description: Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein
Class: Signaling Protein
Keywords: ISG15, Ubiquitin Cross Reactive Protein
Deposited on 2005-03-08, released 2005-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon, alpha-inducible protein (clone IFI-15K)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161
      • engineered (77)
    Domains in SCOP 1.73: d1z2ma1, d1z2ma2
  • Heterogens: OS4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2mA (A:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2mA (A:)
    wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
    qglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlf
    wltfegkpledqlplgeyglkplstvfmnlrl