PDB entry 1z2m

View 1z2m on RCSB PDB site
Description: Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein
Class: Signaling Protein
Keywords: ISG15, Ubiquitin Cross Reactive Protein, Signaling Protein
Deposited on 2005-03-08, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon, alpha-inducible protein (clone IFI-15K)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161
      • engineered (77)
    Domains in SCOPe 2.08: d1z2ma1, d1z2ma2
  • Heterogens: OS4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2mA (A:)
    mgwdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvpl
    asqglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqdd
    lfwltfegkpledqlplgeyglkplstvfmnlrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2mA (A:)
    wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
    qglgpgstvllvvdksdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlf
    wltfegkpledqlplgeyglkplstvfmnlrl