PDB entry 1z2i

View 1z2i on RCSB PDB site
Description: CRYSTAL STRUCTURE OF Agrobacterium tumefaciens MALATE DEHYDROGENASE, NEW YORK STRUCTURAL GENOMICS CONSORTIUM
Class: oxidoreductase
Keywords: MALATE DEHYDROGENASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, OXIDOREDUCTASE
Deposited on 2005-03-08, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_3209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2ia_
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_3209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2ib_
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_3209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2ic_
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_L_3209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2id_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2iA (A:)
    mahgnekatvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllah
    yvtaleggrlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavai
    rnsshfgpagayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpw
    lldmatsavpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaal
    agvveifsavltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkryl
    evlrgsparedckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2iA (A:)
    tvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllahyvtalegg
    rlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavairnsshfgp
    agayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpwlldmatsa
    vpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaalagvveifs
    avltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkrylevlrgspa
    redckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z2iB (B:)
    mahgnekatvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllah
    yvtaleggrlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavai
    rnsshfgpagayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpw
    lldmatsavpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaal
    agvveifsavltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkryl
    evlrgsparedckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2iB (B:)
    tvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllahyvtalegg
    rlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavairnsshfgp
    agayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpwlldmatsa
    vpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaalagvveifs
    avltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkrylevlrgspa
    redckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z2iC (C:)
    mahgnekatvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllah
    yvtaleggrlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavai
    rnsshfgpagayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpw
    lldmatsavpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaal
    agvveifsavltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkryl
    evlrgsparedckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2iC (C:)
    tvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllahyvtalegg
    rlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavairnsshfgp
    agayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpwlldmatsa
    vpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaalagvveifs
    avltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkrylevlrgspa
    redckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z2iD (D:)
    mahgnekatvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllah
    yvtaleggrlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavai
    rnsshfgpagayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpw
    lldmatsavpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaal
    agvveifsavltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkryl
    evlrgsparedckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2iD (D:)
    tvlarldelerfcravflavgtdeetadaatrammhgtrlgvdshgvrllahyvtalegg
    rlnrrpqisrvsgfgavetidadhahgaratyaamenamalaekfgigavairnsshfgp
    agayaleaarqgyiglafcnsdsfvrlhdgamrfhgtnpiavgvpaaddmpwlldmatsa
    vpynrvllyrslgqqlpqgvasdgdgvdtrdpnavemlapvggefgfkgaalagvveifs
    avltgmrlsfdlapmggpdfstprglgafvlalkpeaflerdvfdesmkrylevlrgspa
    redckvmapgdrewavaakreregapvdpvtraafselaekfsvspptyh