PDB entry 1z2g

View 1z2g on RCSB PDB site
Description: Solution structure of apo, oxidized yeast Cox17
Class: chaperone
Keywords: Copper Chaperone, Cytochrome c Oxidase assembly, disulfide bonds, coiled coil-helix-coiled coil-helix domain, Structural Genomics, Structural Proteomics in Europe, SPINE
Deposited on 2005-03-08, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase copper chaperone
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YLL009C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z2gA (A:)
    mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
    ygfevpsan