PDB entry 1z2f

View 1z2f on RCSB PDB site
Description: solution structure of CfAFP-501
Class: antifreeze protein
Keywords: Antifreeze protein, Choristoneura Fumiferana, Spruce Budworm, solution structure
Deposited on 2005-03-08, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antifreeze protein isoform 501
    Species: Choristoneura fumiferana [TaxId:7141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z2fA (A:)
    dgtcvntnsqitansqcvkstatncyidnsqlvdtsictrsqysdanvkksvttdcnidk
    sqvylttctgsqyngiyirsstttgtsisgpgcsistctitrgvatpaaackisgcslsa
    m