PDB entry 1z2e

View 1z2e on RCSB PDB site
Description: Solution Structure of Bacillus subtilis ArsC in oxidized state
Class: Oxidoreductase
Keywords: Bacillus subtilis, Arsenate Reductase, solution structure, structural genomics, Oxidoreductase
Deposited on 2005-03-08, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arsenate reductase
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45947 (0-138)
  Domains in SCOPe 2.08: d1z2ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z2eA (A:)
  menkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
  nqtsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
  qrvrdeignrlkefaetgk