PDB entry 1z2d

View 1z2d on RCSB PDB site
Description: Solution Structure of Bacillus subtilis ArsC in reduced state
Class: Oxidoreductase
Keywords: Bacillus subtilis, Arsenate Reductase, solution structure, Structural Genomics, Oxidoreductase
Deposited on 2005-03-08, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenate reductase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z2dA (A:)
    menkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
    nqtsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
    qrvrdeignrlkefaetgk