PDB entry 1z2c

View 1z2c on RCSB PDB site
Description: Crystal structure of mDIA1 GBD-FH3 in complex with RhoC-GMPPNP
Class: signaling protein
Keywords: armadillo repeat, SIGNALING PROTEIN
Deposited on 2005-03-08, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-related GTP-binding protein RhoC
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOC, ARH9, ARHC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08134 (0-End)
      • engineered (24)
    Domains in SCOPe 2.07: d1z2ca1
  • Chain 'B':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2cb1
  • Chain 'C':
    Compound: Rho-related GTP-binding protein RhoC
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOC, ARH9, ARHC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08134 (0-End)
      • engineered (24)
    Domains in SCOPe 2.07: d1z2cc_
  • Chain 'D':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Diaph1, Diap1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z2cd_
  • Heterogens: MG, GNP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2cA (A:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematraglq
    vrknkrrrgcpil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2cA (A:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z2cB (B:)
    dptaqslqdisdeqvlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmn
    qkessrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkr
    lhdekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmi
    daakllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclql
    inalitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlk
    grlddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieec
    vsqivlhkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2cB (B:)
    vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtsssrsammyiqelrsglrdm
    hllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmn
    nkfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamter
    aemdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqv
    lqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdska
    ephflsilqhlllvrndyearpqyyklieecvsqivlhkngtdpdf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z2cC (C:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematraglq
    vrknkrrrgcpil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2cC (C:)
    maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z2cD (D:)
    dptaqslqdisdeqvlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmn
    qkessrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkr
    lhdekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmi
    daakllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclql
    inalitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlk
    grlddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieec
    vsqivlhkngtdpdfkcrhlqid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2cD (D:)
    vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtsammyiqelrsglrdmhlls
    cleslrvslnnnpvswvqtfgaeglaslldilkrlhdeydsrnqheiirclkafmnnkfg
    iktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamteraemd
    everfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqvlqel
    reienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdskaephf
    lsilqhlllvrndyearpqyyklieecvsqivlhk