PDB entry 1z2b

View 1z2b on RCSB PDB site
Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
Class: cell cycle
Keywords: alpha-tubulin, beta-tubulin, colchicine, gtpase, microtubule, stathmin, tubulin, vinblastine, cell cycle
Deposited on 2005-03-08, released 2005-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.212
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAX09051
      • see remark 999 (6)
      • see remark 999 (15)
      • see remark 999 (49)
      • see remark 999 (53)
      • see remark 999 (77)
      • see remark 999 (79)
      • see remark 999 (81)
      • see remark 999 (116)
      • see remark 999 (125)
      • see remark 999 (231)
      • see remark 999 (333)
    Domains in SCOPe 2.06: d1z2ba1, d1z2ba2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAT84374
      • see remark 999 (169)
      • see remark 999 (315)
    Domains in SCOPe 2.06: d1z2bb1, d1z2bb2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAX09051
      • see remark 999 (6)
      • see remark 999 (15)
      • see remark 999 (49)
      • see remark 999 (53)
      • see remark 999 (77)
      • see remark 999 (79)
      • see remark 999 (81)
      • see remark 999 (116)
      • see remark 999 (125)
      • see remark 999 (231)
      • see remark 999 (333)
    Domains in SCOPe 2.06: d1z2bc1, d1z2bc2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • GB AAT84374
      • see remark 999 (169)
      • see remark 999 (315)
    Domains in SCOPe 2.06: d1z2bd1, d1z2bd2
  • Chain 'E':
    Compound: rb3 stathmin-like domain 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043 (1-End)
      • see remark 999 (0)
    Domains in SCOPe 2.06: d1z2be1, d1z2be2
  • Heterogens: MG, GTP, GDP, CN2, VLB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z2bA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgidsyededegee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2bA (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
    eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
    glqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
    thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnv
    dltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhg
    kymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdlak
    vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
    dyeevgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z2bB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2bB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgr
    yltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
    nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z2bC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgidsyededegee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2bC (C:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsdktidsfntffsetgagkhvpra
    vfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkl
    adqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepy
    nsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd
    galnvdltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprhg
    kymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdlak
    vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
    dyeevgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z2bD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2bD (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgr
    yltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
    nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z2bE (E:)
    admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z2bE (E:)
    admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
    hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
    elke