PDB entry 1z29

View 1z29 on RCSB PDB site
Description: Crystal Structures of SULT1A2 and SULT1A1*3: Implications in the bioactivation of N-hydroxy-2-acetylamino fluorine (OH-AAF)
Class: Transferase
Keywords: SULT1A2, PAP, Cation-pi interaction, Plastic substrate binding pocket, Transferase
Deposited on 2005-03-07, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenol-sulfating phenol sulfotransferase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50226 (Start-294)
      • see remark 999 (234)
    Domains in SCOPe 2.08: d1z29a_
  • Heterogens: CA, A3P, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z29A (A:)
    meliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifmrvpflefkvpgipsgmetlkntpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvyphpgtwesflekfmagevsygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvgrslpeetvdlmvehtsfkemkknpmtny
    ttvrrefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z29A (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggap
    ifmrvpflefkvpgipsgmetlkntpaprllkthlplallpqtlldqkvkvvyvarnakd
    vavsyyhfyhmakvyphpgtwesflekfmagevsygswyqhvqewwelsrthpvlylfye
    dmkenpkreiqkilefvgrslpeetvdlmvehtsfkemkknpmtnyttvrrefmdhsisp
    fmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel