PDB entry 1z28

View 1z28 on RCSB PDB site
Description: Crystal Structures of SULT1A2 and SULT1A1*3: Implications in the bioactivation of N-hydroxy-2-acetylamino fluorine (OH-AAF)
Class: transferase
Keywords: SULT1A1*3, PAP, Plastic substrate binding pocket, Transferase
Deposited on 2005-03-07, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenol-sulfating phenol sulfotransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-294)
      • see remark 999 (222)
    Domains in SCOPe 2.07: d1z28a_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z28A (A:)
    meliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvgrslpeetvdfvvqhtsfkemkknpmtny
    ttvpqefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z28A (A:)
    tsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggd
    lekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvv
    yvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrth
    pvlylfyedmkenpkreiqkilefvgrslpeetvdfvvqhtsfkemkknpmtnyttvpqe
    fmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel