PDB entry 1z27

View 1z27 on RCSB PDB site
Description: crystal structure of native pvs25, an ookinete protein from plasmodium vivax.
Deposited on 2005-03-07, released 2005-12-06
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ookinete surface protein Pvs25
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96555 (5-177)
      • cloning artifact (178-179)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z27A (A:)
    eaeasavtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefg
    qcienpdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcsc
    aigkvpnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgp
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z27A (A:)
    avtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefgqcien
    pdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcscaigkv
    pnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgp