PDB entry 1z26

View 1z26 on RCSB PDB site
Description: Structure of Pyrococcus furiosus Argonaute with bound tungstate
Class: gene regulation
Keywords: Argonaute, tungstate, RNAi
Deposited on 2005-03-07, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute
    Species: Pyrococcus furiosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3D2 (1-770)
      • cloning artifact (0)
      • engineered (4)
    Domains in SCOP 1.73: d1z26a1, d1z26a2
  • Heterogens: WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z26A (A:)
    smkaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenli
    iattkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktf
    gdykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlml
    kdiasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvd
    lkqpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkel
    lenilaevdsdiidkslseievekiaqelenkirvrddkgnsvpisqlnvqksqlllwtn
    ysrkypvilpyevpekfrkireipmfiildsglladiqnfatnefrelvksmyyslakky
    nslakkarstneiglpfldfrgkekvitedlnsdkgiievveqvssfmkgkelglafiaa
    rnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklg
    vkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvd
    mneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknh
    pvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvld
    ifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z26A (A:)
    smkaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyege
    fipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvems
    vikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvyk
    pcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfas
    knykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseie
    vekiaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiil
    dsglladiqnfatnefrelvksmyyslakkykekvitedlnsdkgiievveqvssfmkgk
    elglafiaarnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnl
    lfqvlsklgvkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpiki
    geqrgesvdmneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdiev
    vtmdviknhpvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekq
    sitrqdvldifiltrlnygsirlpapvhyahkfanairnewkikeeflaegflyfv