PDB entry 1z25

View 1z25 on RCSB PDB site
Description: Structure of P.furiosus Argonaute with bound Mn2+
Class: gene regulation
Keywords: Argonaute, PIWI, active site, RNaseH, Mg2+, RNAi, GENE REGULATION
Deposited on 2005-03-07, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3D2 (1-770)
      • cloning artifact (0)
      • engineered (4)
    Domains in SCOPe 2.07: d1z25a1, d1z25a3, d1z25a4, d1z25a5
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z25A (A:)
    smkaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenli
    iattkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktf
    gdykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlml
    kdiasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvd
    lkqpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkel
    lenilaevdsdiidkslseievekiaqelenkirvrddkgnsvpisqlnvqksqlllwtn
    ysrkypvilpyevpekfrkireipmfiildsglladiqnfatnefrelvksmyyslakky
    nslakkarstneiglpfldfrgkekvitedlnsdkgiievveqvssfmkgkelglafiaa
    rnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklg
    vkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvd
    mneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknh
    pvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvld
    ifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z25A (A:)
    smkaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyege
    fipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvems
    vikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvyk
    pcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfas
    knykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseie
    vekiaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiil
    dsglladiqnfatnefrelvksmyyekvitedlnsdkgiievveqvssfmkgkelglafi
    aarnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsk
    lgvkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrges
    vdmneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdvik
    nhpvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdv
    ldifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv