PDB entry 1z24

View 1z24 on RCSB PDB site
Description: The molecular structure of insecticyanin from the tobacco hornworm Manduca sexta L. at 2.6 A resolution.
Class: lipid binding protein
Keywords: Blue biliprotein, INS-a, Chromophore binding., LIPID BINDING PROTEIN
Deposited on 2005-03-07, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insecticyanin A form
    Species: Manduca sexta [TaxId:7130]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z24a1
  • Heterogens: BLV

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z24A (A:)
    gdifypgycpdvkpvndfdlsafagawheiaklplenenqgkctiaeykydgkkasvyns
    fvsngvkeymegdleiapdakytkqgkyvmtfkfgqrvvnlvpwvlatdyknyainyncd
    yhpdkkahsihawilskskvlegntkevvdnvlktfshlidaskfisndfseaacqystt
    ysltgpdrh