PDB entry 1z24

View 1z24 on RCSB PDB site
Description: The molecular structure of insecticyanin from the tobacco hornworm Manduca sexta L. at 2.6 A resolution.
Class: lipid binding protein
Keywords: Blue biliprotein, INS-a, Chromophore binding., LIPID BINDING PROTEIN
Deposited on 2005-03-07, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Insecticyanin A form
  Species: Manduca sexta [TaxId:7130]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00305 (0-188)
  Domains in SCOPe 2.08: d1z24a1
• Heterogens: BLV

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z24A (A:)
  gdifypgycpdvkpvndfdlsafagawheiaklplenenqgkctiaeykydgkkasvyns
  fvsngvkeymegdleiapdakytkqgkyvmtfkfgqrvvnlvpwvlatdyknyainyncd
  yhpdkkahsihawilskskvlegntkevvdnvlktfshlidaskfisndfseaacqystt
  ysltgpdrh