PDB entry 1z23

View 1z23 on RCSB PDB site
Description: The serine-rich domain from Crk-associated substrate (p130Cas)
Deposited on 2005-03-07, released 2005-04-05
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRK-associated substrate
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767 (0-162)
      • engineered (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z23A (A:)
    gsgreplelevavetlarlqqgvsttvahlldlvgsasgpggwrstsepqeppvqdlkaa
    vaavhgavhellefarsavssathtsdrtlhaklsrqlqkmedvyqtlvvhgqvldsgrg
    gpgftlddldrlvacsravpedakqlasflhgnasllfrrtka