PDB entry 1z21

View 1z21 on RCSB PDB site
Description: Crystal structure of the core domain of Yersinia pestis virulence factor YopR
Class: cell invasion
Keywords: Yersinia pestis, plague, type III secretion, YopR, yop
Deposited on 2005-03-07, released 2005-06-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Yop proteins translocation protein H
    Species: Yersinia pestis
    Gene: yscH, lcrP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z21a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1z21A (A:)
lksesaektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelr
svlqqfdsfgkrweaillqvlegikpnesqvglpylselinkelmillpsns

    Sequence, based on observed residues (ATOM records): (download) 
    >1z21A (A:)
saektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelrsvlq
qfdsfgkrweaillqvlegilpylselinkelmill