PDB entry 1z1y

View 1z1y on RCSB PDB site
Description: crystal structure of methylated pvs25, an ookinete protein from plasmodium vivax
Deposited on 2005-03-07, released 2005-12-06
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.245
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ookinete surface protein Pvs25
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96555 (5-177)
      • modified residue (13)
      • modified residue (25)
      • modified residue (43)
      • modified residue (47-48)
      • modified residue (53)
      • modified residue (74)
      • modified residue (84)
      • modified residue (96)
      • modified residue (123)
      • modified residue (131-132)
      • modified residue (135)
      • modified residue (144)
      • modified residue (153)
      • modified residue (160)
      • modified residue (171)
      • modified residue (173)
      • expression tag (178-181)
  • Chain 'B':
    Compound: ookinete surface protein Pvs25
    Species: Plasmodium vivax [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96555 (5-177)
      • modified residue (13)
      • modified residue (25)
      • modified residue (43)
      • modified residue (47-48)
      • modified residue (53)
      • modified residue (74)
      • modified residue (84)
      • modified residue (96)
      • modified residue (123)
      • modified residue (131-132)
      • modified residue (135)
      • modified residue (144)
      • modified residue (153)
      • modified residue (160)
      • modified residue (171)
      • modified residue (173)
      • expression tag (178-179)
  • Heterogens: YB, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z1yA (A:)
    eaeasavtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefg
    qcienpdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcsc
    aigkvpnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgp
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z1yA (A:)
    avtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefgqcien
    pdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcscaigkv
    pnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgphh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z1yB (B:)
    eaeasavtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefg
    qcienpdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcsc
    aigkvpnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgp
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z1yB (B:)
    avtvdtickngqlvqmsnhfkcmcneglvhlsentceekneckketlgkacgefgqcien
    pdpaqvnmykcgciegytlkedtcvldvcqykncgesgeciveylseiqsagcscaigkv
    pnpedekkctktgetacqlkcntdnevcknvegvykcqcmegftfdkeknvclgp