PDB entry 1z1x

View 1z1x on RCSB PDB site
Description: Crystal Structure of a novel disintegrin from Saw-scaled viper at 3.2 A resolution
Deposited on 2005-03-07, released 2005-04-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.236
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: disintegrin
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z1xA (A:)
    nsvhpccdpvkcepregehcisgpccrnckflnagtickramldglhdyctgvtsdcprn
    rynh