PDB entry 1z1w

View 1z1w on RCSB PDB site
Description: Crystal structures of the tricorn interacting facor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different conformations
Class: hydrolase
Keywords: zinc aminopeptidase, Gluzincins, superhelix, HYDROLASE
Deposited on 2005-03-07, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tricorn protease interacting factor F3
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z1wa1, d1z1wa2, d1z1wa3, d1z1wa4
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z1wA (A:)
    mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
    rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav
    faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkfryeyekyrdi
    dlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgagamenwgaitf
    reiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesfatfmsyktmd
    tlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeisygkgasilrm
    iedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeywiknpgypvik
    lkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadglikinads
    agfyrvlyddatfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffdde
    dhnvitaivgqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvd
    esyaeemsklfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafg
    klksntdlstvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgn
    rtasrtvemmipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk