PDB entry 1z1v

View 1z1v on RCSB PDB site
Description: NMR structure of the Saccharomyces cerevisiae Ste50 SAM domain
Class: cell cycle
Keywords: all helix protein, SAM domain
Deposited on 2005-03-06, released 2006-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ste50 protein
    Species: Saccharomyces cerevisiae
    Gene: STE50
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z1va1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z1vA (A:)
    gshmfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdln
    kaikfkilinkmrdsklewk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z1vA (A:)
    sqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdlnkaikf
    kilinkmrds