PDB entry 1z1s

View 1z1s on RCSB PDB site
Description: Crystal Structure of Putative Isomerase PA3332 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: beta barrel, conserved hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-03-06, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.172
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Protein PA3332
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA3332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYR3 (22-End)
      • cloning artifact (15-21)
    Domains in SCOPe 2.07: d1z1sa1, d1z1sa2
  • Heterogens: MG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1z1sA (A:)
mgsshhhhhhssgrenlyfqghmnakeilvhslrllengdargwcdlfhpegvlefpyap
pgwktrfegretiwahmrlfpehltvrftdvqfyetadpdlaigefhgdgvatvsggkla
qdyisvlrtrdgqillyrdfwnplrhlealggveaaakivqga

    Sequence, based on observed residues (ATOM records): (download) 
    >1z1sA (A:)
nlyfqghmnakeilvhslrllengdargwcdlfhpegvlefpyappgwktrfegretiwa
hmrlfpehltvrftdvqfyetadpdlaigefhgdgvatvsggklaqdyisvlrtrdgqil
lyrdfwnplrhlealg