PDB entry 1z1r
View 1z1r on RCSB PDB site
Description: HIV-1 protease complexed with Macrocyclic peptidomimetic inhibitor 2
Class: hydrolase
Keywords: macrocyclic inhibitors, peptidomimetic inhibitors, HIV1 protease
Deposited on
2005-03-06, released
2005-03-22
The last revision prior to the SCOP 1.75 freeze date was dated
2005-03-22, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.62
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Uniprot P03369
- engineered (6)
- engineered (32)
- engineered (66)
- engineered (94)
Domains in SCOP 1.75: d1z1ra1 - Chain 'B':
Compound: Pol polyprotein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (32)
- engineered (66)
- engineered (94)
Domains in SCOP 1.75: d1z1rb1 - Heterogens: SO4, HBH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1z1rA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1z1rB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf