PDB entry 1z1r

View 1z1r on RCSB PDB site
Description: HIV-1 protease complexed with Macrocyclic peptidomimetic inhibitor 2
Class: hydrolase
Keywords: macrocyclic inhibitors, peptidomimetic inhibitors, HIV1 protease
Deposited on 2005-03-06, released 2005-03-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.176
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.75: d1z1ra1
• Chain 'B':
  Compound: Pol polyprotein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOP 1.75: d1z1rb1
• Heterogens: SO4, HBH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z1rA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z1rB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf